Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Ran [52609] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [52611] (28 PDB entries) |
Domain d1i2mc_: 1i2m C: [61570] Other proteins in same PDB: d1i2mb_, d1i2md_ complexed to RCC1 complexed with so4 |
PDB Entry: 1i2m (more details), 1.76 Å
SCOPe Domain Sequences for d1i2mc_:
Sequence, based on SEQRES records: (download)
>d1i2mc_ c.37.1.8 (C:) Ran {Human (Homo sapiens) [TaxId: 9606]} qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefv
>d1i2mc_ c.37.1.8 (C:) Ran {Human (Homo sapiens) [TaxId: 9606]} qvqfklvlvgdggtgkttfvkrhlkyvatlgvevhplvfhtnrgpikfnvwdtagqekfg glrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikdrkvka ksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefv
Timeline for d1i2mc_: