Lineage for d1i2mb_ (1i2m B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62854Fold b.69: 7-bladed beta-propeller [50964] (7 superfamilies)
  4. 62912Superfamily b.69.5: Regulator of chromosome condensation RCC1 [50985] (1 family) (S)
  5. 62913Family b.69.5.1: Regulator of chromosome condensation RCC1 [50986] (1 protein)
  6. 62914Protein Regulator of chromosome condensation RCC1 [50987] (1 species)
  7. 62915Species Human (Homo sapiens) [TaxId:9606] [50988] (2 PDB entries)
  8. 62919Domain d1i2mb_: 1i2m B: [61569]
    Other proteins in same PDB: d1i2ma_, d1i2mc_

Details for d1i2mb_

PDB Entry: 1i2m (more details), 1.76 Å

PDB Description: ran-rcc1-so4 complex

SCOP Domain Sequences for d1i2mb_:

Sequence, based on SEQRES records: (download)

>d1i2mb_ b.69.5.1 (B:) Regulator of chromosome condensation RCC1 {Human (Homo sapiens)}
kvshrshstepglvltlgqgdvgqlglgenvmerkkpalvsipedvvqaeaggmhtvcls
ksgqvysfgcndegalgrdtsvegsemvpgkvelqekvvqvsagdshtaaltddgrvflw
gsfrdnngvigllepmkksmvpvqvqldvpvvkvasgndhlvmltadgdlytlgcgeqgq
lgrvpelfanrggrqglerllvpkcvmlksrgsrghvrfqdafcgayftfaisheghvyg
fglsnyhqlgtpgtescfipqnltsfknstkswvgfsggqhhtvcmdsegkayslgraey
grlglgegaeeksiptlisrlpavssvacgasvgyavtkdgrvfawgmgtnyqlgtgqde
dawspvemmgkqlenrvvlsvssggqhtvllvkd

Sequence, based on observed residues (ATOM records): (download)

>d1i2mb_ b.69.5.1 (B:) Regulator of chromosome condensation RCC1 {Human (Homo sapiens)}
kvshrshstepglvltlgqgdvgqlglgenvmerkkpalvsipedvvqaeaggmhtvcls
ksgqvysfgcndegalgrdtsvegsemvpgkvelqekvvqvsagdshtaaltddgrvflw
gsfrdnngvigllepmkksmvpvqvqldvpvvkvasgndhlvmltadgdlytlgcgeqgq
lgrvpelfanrggrqglerllvpkcvmlkhvrfqdafcgayftfaisheghvygfglsny
hqlgtpgtescfipqnltsfknstkswvgfsggqhhtvcmdsegkayslgraeygrlglg
egaeeksiptlisrlpavssvacgasvgyavtkdgrvfawgmgtnyqlgtgqdedawspv
emmgkqlenrvvlsvssggqhtvllvkd

SCOP Domain Coordinates for d1i2mb_:

Click to download the PDB-style file with coordinates for d1i2mb_.
(The format of our PDB-style files is described here.)

Timeline for d1i2mb_: