Lineage for d1i2mb_ (1i2m B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066236Superfamily b.69.5: RCC1/BLIP-II [50985] (2 families) (S)
    two families are clearly related but differ by the number of strands per blade
  5. 2066237Family b.69.5.1: Regulator of chromosome condensation RCC1 [50986] (1 protein)
  6. 2066238Protein Regulator of chromosome condensation RCC1 [50987] (1 species)
  7. 2066239Species Human (Homo sapiens) [TaxId:9606] [50988] (2 PDB entries)
  8. 2066243Domain d1i2mb_: 1i2m B: [61569]
    Other proteins in same PDB: d1i2ma_, d1i2mc_
    complexed to Ran
    complexed with so4

Details for d1i2mb_

PDB Entry: 1i2m (more details), 1.76 Å

PDB Description: ran-rcc1-so4 complex
PDB Compounds: (B:) regulator of chromosome condensation 1

SCOPe Domain Sequences for d1i2mb_:

Sequence, based on SEQRES records: (download)

>d1i2mb_ b.69.5.1 (B:) Regulator of chromosome condensation RCC1 {Human (Homo sapiens) [TaxId: 9606]}
kvshrshstepglvltlgqgdvgqlglgenvmerkkpalvsipedvvqaeaggmhtvcls
ksgqvysfgcndegalgrdtsvegsemvpgkvelqekvvqvsagdshtaaltddgrvflw
gsfrdnngvigllepmkksmvpvqvqldvpvvkvasgndhlvmltadgdlytlgcgeqgq
lgrvpelfanrggrqglerllvpkcvmlksrgsrghvrfqdafcgayftfaisheghvyg
fglsnyhqlgtpgtescfipqnltsfknstkswvgfsggqhhtvcmdsegkayslgraey
grlglgegaeeksiptlisrlpavssvacgasvgyavtkdgrvfawgmgtnyqlgtgqde
dawspvemmgkqlenrvvlsvssggqhtvllvkd

Sequence, based on observed residues (ATOM records): (download)

>d1i2mb_ b.69.5.1 (B:) Regulator of chromosome condensation RCC1 {Human (Homo sapiens) [TaxId: 9606]}
kvshrshstepglvltlgqgdvgqlglgenvmerkkpalvsipedvvqaeaggmhtvcls
ksgqvysfgcndegalgrdtsvegsemvpgkvelqekvvqvsagdshtaaltddgrvflw
gsfrdnngvigllepmkksmvpvqvqldvpvvkvasgndhlvmltadgdlytlgcgeqgq
lgrvpelfanrggrqglerllvpkcvmlkhvrfqdafcgayftfaisheghvygfglsny
hqlgtpgtescfipqnltsfknstkswvgfsggqhhtvcmdsegkayslgraeygrlglg
egaeeksiptlisrlpavssvacgasvgyavtkdgrvfawgmgtnyqlgtgqdedawspv
emmgkqlenrvvlsvssggqhtvllvkd

SCOPe Domain Coordinates for d1i2mb_:

Click to download the PDB-style file with coordinates for d1i2mb_.
(The format of our PDB-style files is described here.)

Timeline for d1i2mb_: