SCOPe 2.08: Domain d1i2ma_: 1i2m A:

Lineage for d1i2ma_ (1i2m A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Ran [52609] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52611] (90 PDB entries)

8. Domain d1i2ma_: 1i2m A: [61568]
   Other proteins in same PDB: d1i2mb_, d1i2md_
   complexed to RCC1
   complexed with so4
   has additional insertions and/or extensions that are not grouped together

Details for d1i2ma_

PDB Entry: 1i2m, 1.76 Å

PDB Description: ran-rcc1-so4 complex

PDB Compounds: (A:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d1i2ma_:

Sequence, based on SEQRES records:

>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefv

Sequence, based on observed residues (ATOM records):

>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}
qvqfklvlvgdggtgkttfvkrhlkkyvatlgvevhplvfhtnrgpikfnvwdtagqekf
gglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikdrkvk
aksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefv

Timeline for d1i2ma_:

• d1i2ma_ first appeared in SCOP 1.57
  
• d1i2ma_ appears in SCOPe 2.07