Lineage for d1i2ga_ (1i2g A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 75820Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
  4. 75821Superfamily d.1.1: Microbial ribonucleases [53933] (1 family) (S)
  5. 75822Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins)
  6. 75968Protein RNase T1 [53939] (2 species)
  7. 75971Species Aspergillus oryzae [TaxId:5062] [53940] (59 PDB entries)
  8. 75994Domain d1i2ga_: 1i2g A: [61567]

Details for d1i2ga_

PDB Entry: 1i2g (more details), 1.85 Å

PDB Description: ribonuclease t1 v16t mutant

SCOP Domain Sequences for d1i2ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i2ga_ d.1.1.1 (A:) RNase T1 {Aspergillus oryzae}
acdytcgsncysssdtstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect

SCOP Domain Coordinates for d1i2ga_:

Click to download the PDB-style file with coordinates for d1i2ga_.
(The format of our PDB-style files is described here.)

Timeline for d1i2ga_: