Lineage for d1i2dc2 (1i2d C:171-390)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 579981Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 579982Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 580273Family c.26.1.5: ATP sulfurylase central domain [63979] (1 protein)
  6. 580274Protein ATP sulfurylase central domain [63980] (4 species)
  7. 580290Species Fungus (Penicillium chrysogenum) [TaxId:5076] [63982] (2 PDB entries)
  8. 580296Domain d1i2dc2: 1i2d C:171-390 [61563]
    Other proteins in same PDB: d1i2da1, d1i2da3, d1i2db1, d1i2db3, d1i2dc1, d1i2dc3
    complexed with adx

Details for d1i2dc2

PDB Entry: 1i2d (more details), 2.81 Å

PDB Description: crystal structure of atp sulfurylase from penicillium chrysogenum

SCOP Domain Sequences for d1i2dc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i2dc2 c.26.1.5 (C:171-390) ATP sulfurylase central domain {Fungus (Penicillium chrysogenum)}
yvalrytpaelrvhfdklgwsrvvafqtrnpmhrahreltvraarsrqanvlihpvvglt
kpgdidhftrvrayqallprypngmavlgllglamrmggpreaiwhaiirknhgathfiv
grdhagpgsnskgedfygpydaqhavekykdelgievvefqmvtylpdtdeyrpvdqvpa
gvktlnisgtelrrrlrsgahipewfsypevvkilresnp

SCOP Domain Coordinates for d1i2dc2:

Click to download the PDB-style file with coordinates for d1i2dc2.
(The format of our PDB-style files is described here.)

Timeline for d1i2dc2: