Lineage for d1i2db2 (1i2d B:171-390)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 482378Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 482379Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 482667Family c.26.1.5: ATP sulfurylase central domain [63979] (1 protein)
  6. 482668Protein ATP sulfurylase central domain [63980] (4 species)
  7. 482684Species Fungus (Penicillium chrysogenum) [TaxId:5076] [63982] (2 PDB entries)
  8. 482689Domain d1i2db2: 1i2d B:171-390 [61560]
    Other proteins in same PDB: d1i2da1, d1i2da3, d1i2db1, d1i2db3, d1i2dc1, d1i2dc3

Details for d1i2db2

PDB Entry: 1i2d (more details), 2.81 Å

PDB Description: crystal structure of atp sulfurylase from penicillium chrysogenum

SCOP Domain Sequences for d1i2db2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i2db2 c.26.1.5 (B:171-390) ATP sulfurylase central domain {Fungus (Penicillium chrysogenum)}
yvalrytpaelrvhfdklgwsrvvafqtrnpmhrahreltvraarsrqanvlihpvvglt
kpgdidhftrvrayqallprypngmavlgllglamrmggpreaiwhaiirknhgathfiv
grdhagpgsnskgedfygpydaqhavekykdelgievvefqmvtylpdtdeyrpvdqvpa
gvktlnisgtelrrrlrsgahipewfsypevvkilresnp

SCOP Domain Coordinates for d1i2db2:

Click to download the PDB-style file with coordinates for d1i2db2.
(The format of our PDB-style files is described here.)

Timeline for d1i2db2: