Lineage for d1i2da2 (1i2d A:171-390)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68936Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
  4. 68937Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 69024Family c.26.1.5: ATP sulfurylase central domain [63979] (1 protein)
  6. 69025Protein ATP sulfurylase central domain [63980] (2 species)
  7. 69032Species Fungus (Penicillium chrysogenum) [TaxId:5076] [63982] (1 PDB entry)
  8. 69033Domain d1i2da2: 1i2d A:171-390 [61557]
    Other proteins in same PDB: d1i2da1, d1i2da3, d1i2db1, d1i2db3, d1i2dc1, d1i2dc3

Details for d1i2da2

PDB Entry: 1i2d (more details), 2.81 Å

PDB Description: crystal structure of atp sulfurylase from penicillium chrysogenum

SCOP Domain Sequences for d1i2da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i2da2 c.26.1.5 (A:171-390) ATP sulfurylase central domain {Fungus (Penicillium chrysogenum)}
yvalrytpaelrvhfdklgwsrvvafqtrnpmhrahreltvraarsrqanvlihpvvglt
kpgdidhftrvrayqallprypngmavlgllglamrmggpreaiwhaiirknhgathfiv
grdhagpgsnskgedfygpydaqhavekykdelgievvefqmvtylpdtdeyrpvdqvpa
gvktlnisgtelrrrlrsgahipewfsypevvkilresnp

SCOP Domain Coordinates for d1i2da2:

Click to download the PDB-style file with coordinates for d1i2da2.
(The format of our PDB-style files is described here.)

Timeline for d1i2da2: