![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
![]() | Superfamily b.122.1: PUA domain-like [88697] (7 families) ![]() |
![]() | Family b.122.1.3: ATP sulfurylase N-terminal domain [63801] (1 protein) contains extra structures; some similarity to the PK beta-barrel domain |
![]() | Protein ATP sulfurylase N-terminal domain [63802] (4 species) |
![]() | Species Fungus (Penicillium chrysogenum) [TaxId:5076] [63804] (2 PDB entries) |
![]() | Domain d1i2da1: 1i2d A:2-170 [61556] Other proteins in same PDB: d1i2da2, d1i2da3, d1i2db2, d1i2db3, d1i2dc2, d1i2dc3 |
PDB Entry: 1i2d (more details), 2.81 Å
SCOP Domain Sequences for d1i2da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i2da1 b.122.1.3 (A:2-170) ATP sulfurylase N-terminal domain {Fungus (Penicillium chrysogenum)} anaphggvlkdllardaprqaelaaeaeslpavtlterqlcdlelimnggfsplegfmnq adydrvcednrladgnvfsmpitldasqevidekklqagsritlrdfrddrnlailtidd iyrpdktkeaklvfggdpehpaivylnntvkefyiggkieavnklnhyd
Timeline for d1i2da1: