Lineage for d1i21y_ (1i21 Y:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (2 families) 
Family d.108.1.1: N-acetyl transferase, NAT [55730] (9 proteins) Protein Glucosamine-phoshate N-acetyltransferase GNA1 [64351] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64352] (3 PDB entries) 
Domain d1i21y_: 1i21 Y: [61554]
Details for d1i21y_
PDB Entry: 1i21 (more details), 2.4 Å
PDB Description: crystal structure of yeast gna1
SCOP Domain Sequences for d1i21y_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i21y_ d.108.1.1 (Y:) Glucosamine-phoshate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae)}
lpdgfyirrmeegdleqvtetlkvlttvgtitpesfcklikywneatvwndnedkkimqy
npmvivdkrtetvaatgniiierkiihelglcghiediavnskyqgqglgkllidqlvti
gfdygcykiildcdeknvkfyekcgfsnagvemqir
SCOP Domain Coordinates for d1i21y_:
Click to download the PDB-style file with coordinates for d1i21y_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i21y_:
- d1i21y_ is new in SCOP 1.57
- d1i21y_ appears in SCOP 1.59
- d1i21y_ appears in the current release, SCOPe 2.08
View in 3D
