SCOP 1.75: Domain d1i1rb_: 1i1r B:

Lineage for d1i1rb_ (1i1r B:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (3 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.1: Long-chain cytokines [47267] (9 proteins)

6. Protein Interleukin-6 [47272] (2 species)

7. Species Human herpesvirus 8, Kaposi's sarcoma herpes-virus [TaxId:37296] [63528] (1 PDB entry)

8. Domain d1i1rb_: 1i1r B: [61548]
   Other proteins in same PDB: d1i1ra1, d1i1ra2, d1i1ra3

Details for d1i1rb_

PDB Entry: 1i1r, 2.4 Å

PDB Description: crystal structure of a cytokine/receptor complex

PDB Compounds: (B:) viral il-6

SCOP Domain Sequences for d1i1rb_:

Sequence; same for both SEQRES and ATOM records:

>d1i1rb_ a.26.1.1 (B:) Interleukin-6 {Human herpesvirus 8, Kaposi's sarcoma herpes-virus [TaxId: 37296]}
efekdlliqrlnwmlwvidecfrdlcyrtgickgilepaaifhlklpaindtdhcgligf
netsclkkladgffefevlfkflttefgksvinvdvmelltktlgwdiqeelnkltkthy
sppkfdrgllgrlqglkywvrhfasfyvlsamekfagqavrvldsip

Timeline for d1i1rb_:

• d1i1rb_ first appeared in SCOP 1.57
  
• d1i1rb_ appears in SCOP 1.73
  
• d1i1rb_ appears in SCOPe 2.01
  
• d1i1rb_ appears in the current release, SCOPe 2.08