Lineage for d1i1ra3 (1i1r A:197-302)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 787437Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 787438Family b.1.2.1: Fibronectin type III [49266] (44 proteins)
    Pfam PF00041
  6. 787479Protein Cytokine receptor gp130 cytokine-binding domains [49295] (1 species)
  7. 787480Species Human (Homo sapiens) [TaxId:9606] [49296] (5 PDB entries)
  8. 787487Domain d1i1ra3: 1i1r A:197-302 [61547]
    Other proteins in same PDB: d1i1rb_
    complexed with a cytokine

Details for d1i1ra3

PDB Entry: 1i1r (more details), 2.4 Å

PDB Description: crystal structure of a cytokine/receptor complex
PDB Compounds: (A:) interleukin-6 receptor beta chain

SCOP Domain Sequences for d1i1ra3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1ra3 b.1.2.1 (A:197-302) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]}
kvkpnpphnlsvinseelssilkltwtnpsiksviilkyniqyrtkdastwsqippedta
strssftvqdlkpfteyvfrircmkedgkgywsdwseeasgityed

SCOP Domain Coordinates for d1i1ra3:

Click to download the PDB-style file with coordinates for d1i1ra3.
(The format of our PDB-style files is described here.)

Timeline for d1i1ra3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1i1rb_