Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (1 family) |
Family b.1.2.1: Fibronectin type III [49266] (44 proteins) Pfam PF00041 |
Protein Cytokine receptor gp130 cytokine-binding domains [49295] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49296] (5 PDB entries) |
Domain d1i1ra3: 1i1r A:197-302 [61547] Other proteins in same PDB: d1i1rb_ complexed with a cytokine |
PDB Entry: 1i1r (more details), 2.4 Å
SCOP Domain Sequences for d1i1ra3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i1ra3 b.1.2.1 (A:197-302) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} kvkpnpphnlsvinseelssilkltwtnpsiksviilkyniqyrtkdastwsqippedta strssftvqdlkpfteyvfrircmkedgkgywsdwseeasgityed
Timeline for d1i1ra3: