Lineage for d1i1ra2 (1i1r A:102-196)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 550820Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 550821Family b.1.2.1: Fibronectin type III [49266] (28 proteins)
    Pfam 00041
  6. 550840Protein Cytokine receptor gp130 cytokine-binding domains [49295] (1 species)
  7. 550841Species Human (Homo sapiens) [TaxId:9606] [49296] (5 PDB entries)
  8. 550847Domain d1i1ra2: 1i1r A:102-196 [61546]
    Other proteins in same PDB: d1i1rb_

Details for d1i1ra2

PDB Entry: 1i1r (more details), 2.4 Å

PDB Description: crystal structure of a cytokine/receptor complex

SCOP Domain Sequences for d1i1ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1ra2 b.1.2.1 (A:102-196) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens)}
lppekpknlscivnegkkmrcewdggrethletnftlksewathkfadckakrdtptsct
vdystvyfvnievwveaenalgkvtsdhinfdpvy

SCOP Domain Coordinates for d1i1ra2:

Click to download the PDB-style file with coordinates for d1i1ra2.
(The format of our PDB-style files is described here.)

Timeline for d1i1ra2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1i1rb_