Lineage for d1i1ra1 (1i1r A:2-101)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 105235Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 105236Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 105249Protein Cytokyne receptor gp130 cytokine-binding domains [49295] (1 species)
  7. 105250Species Human (Homo sapiens) [TaxId:9606] [49296] (3 PDB entries)
  8. 105255Domain d1i1ra1: 1i1r A:2-101 [61545]
    Other proteins in same PDB: d1i1rb_

Details for d1i1ra1

PDB Entry: 1i1r (more details), 2.4 Å

PDB Description: crystal structure of a cytokine/receptor complex

SCOP Domain Sequences for d1i1ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1ra1 b.1.2.1 (A:2-101) Cytokyne receptor gp130 cytokine-binding domains {Human (Homo sapiens)}
lldpcgyispespvvqlhsnftavcvlkekcmdyfhvnanyivwktnhftipkeqytiin
rtassvtftdiaslniqltcniltfgqleqnvygitiisg

SCOP Domain Coordinates for d1i1ra1:

Click to download the PDB-style file with coordinates for d1i1ra1.
(The format of our PDB-style files is described here.)

Timeline for d1i1ra1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1i1rb_