Lineage for d1i1oa_ (1i1o A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.23: Flavodoxin-like [52171] (17 superfamilies) 
Superfamily c.23.5: Flavoproteins [52218] (3 families) 
Family c.23.5.1: Flavodoxin-related [52219] (3 proteins) Protein Flavodoxin [52220] (7 species) Species Desulfovibrio vulgaris [TaxId:881] [52222] (20 PDB entries) 
Domain d1i1oa_: 1i1o A: [61542]
Details for d1i1oa_
PDB Entry: 1i1o (more details), 2 Å
PDB Description: room temperature crystal structure flavodoxin d. vulgaris mutant y98h at 2.0 ang. resolution
SCOP Domain Sequences for d1i1oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i1oa_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris}
akalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
ddsielqddfiplfdsleetgaqgrkvacfgcgdssheyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai
SCOP Domain Coordinates for d1i1oa_:
Click to download the PDB-style file with coordinates for d1i1oa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i1oa_:
- d1i1oa_ first appeared in SCOP 1.57
- d1i1oa_ appears in SCOP 1.61
- d1i1oa_ appears in the current release, SCOPe 2.08
View in 3D