Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein Melanoma inhibitory activity protein [63746] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63747] (4 PDB entries) |
Domain d1i1jb_: 1i1j B: [61532] |
PDB Entry: 1i1j (more details), 1.39 Å
SCOPe Domain Sequences for d1i1jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i1jb_ b.34.2.1 (B:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} mpkladrklcadqecshpismavalqdymapdcrfltihrgqvvyvfsklkgrgrlfwgg svqgdyygdlaarlgyfpssivredqtlkpgkvdvktdkwdfyc
Timeline for d1i1jb_: