Lineage for d1i1jb_ (1i1j B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58264Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 58293Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 58294Family b.34.2.1: SH3-domain [50045] (18 proteins)
  6. 58420Protein Melanoma inhibitory activity protein [63746] (1 species)
  7. 58421Species Human (Homo sapiens) [TaxId:9606] [63747] (1 PDB entry)
  8. 58423Domain d1i1jb_: 1i1j B: [61532]

Details for d1i1jb_

PDB Entry: 1i1j (more details), 1.39 Å

PDB Description: structure of melanoma inhibitory activity protein: a member of a new family of secreted proteins
PDB Compounds: (B:)

SCOP Domain Sequences for d1i1jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1jb_ b.34.2.1 (B:) Melanoma inhibitory activity protein {Human (Homo sapiens)}
mpkladrklcadqecshpismavalqdymapdcrfltihrgqvvyvfsklkgrgrlfwgg
svqgdyygdlaarlgyfpssivredqtlkpgkvdvktdkwdfyc

SCOP Domain Coordinates for d1i1jb_:

Click to download the PDB-style file with coordinates for d1i1jb_.
(The format of our PDB-style files is described here.)

Timeline for d1i1jb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1i1ja_