SCOP 1.57: Domain d1i1jb_: 1i1j B:

Lineage for d1i1jb_ (1i1j B:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.34: SH3-like barrel [50036] (9 superfamilies)

4. Superfamily b.34.2: SH3-domain [50044] (1 family)

5. Family b.34.2.1: SH3-domain [50045] (18 proteins)

6. Protein Melanoma inhibitory activity protein [63746] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63747] (1 PDB entry)

8. Domain d1i1jb_: 1i1j B: [61532]

Details for d1i1jb_

PDB Entry: 1i1j, 1.39 Å

PDB Description: structure of melanoma inhibitory activity protein: a member of a new family of secreted proteins

SCOP Domain Sequences for d1i1jb_:

Sequence; same for both SEQRES and ATOM records:

>d1i1jb_ b.34.2.1 (B:) Melanoma inhibitory activity protein {Human (Homo sapiens)}
mpkladrklcadqecshpismavalqdymapdcrfltihrgqvvyvfsklkgrgrlfwgg
svqgdyygdlaarlgyfpssivredqtlkpgkvdvktdkwdfyc

Timeline for d1i1jb_:

• d1i1jb_ is new in SCOP 1.57
  
• d1i1jb_ appears in SCOP 1.59
  
• d1i1jb_ appears in the current release, SCOPe 2.08