Lineage for d1i1ha_ (1i1h A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1840957Superfamily c.23.17: Precorrin-8X methylmutase CbiC/CobH [63965] (1 family) (S)
    fold elaborated with additional structures
    automatically mapped to Pfam PF02570
  5. 1840958Family c.23.17.1: Precorrin-8X methylmutase CbiC/CobH [63966] (3 proteins)
  6. 1840959Protein Precorrin-8x methylmutase [63967] (2 species)
  7. 1840960Species Pseudomonas denitrificans [TaxId:43306] [63968] (2 PDB entries)
  8. 1840962Domain d1i1ha_: 1i1h A: [61530]
    complexed with coj

Details for d1i1ha_

PDB Entry: 1i1h (more details), 2.6 Å

PDB Description: crystal structure analysis of precorrin-8x methylmutase complex with hydrogenobyrinic acid
PDB Compounds: (A:) precorrin-8x methylmutase

SCOPe Domain Sequences for d1i1ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1ha_ c.23.17.1 (A:) Precorrin-8x methylmutase {Pseudomonas denitrificans [TaxId: 43306]}
peydyirdgnaiyersfaiiraeadlsrfseeeadlavrmvhacgsveatrqfvfspdfv
ssaraalkagapilcdaemvahgvtrarlpagnevictlrdprtpalaaeigntrsaaal
klwserlagsvvaignaptalffllemlrdgapkpaailgmpvgfvgaaeskdalaensy
gvpfaivrgrlggsamtaaalnslarpgl

SCOPe Domain Coordinates for d1i1ha_:

Click to download the PDB-style file with coordinates for d1i1ha_.
(The format of our PDB-style files is described here.)

Timeline for d1i1ha_: