Lineage for d1i1db_ (1i1d B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209198Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2209271Protein Glucosamine-phosphate N-acetyltransferase GNA1 [64351] (1 species)
  7. 2209272Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64352] (3 PDB entries)
  8. 2209278Domain d1i1db_: 1i1d B: [61527]
    Other proteins in same PDB: d1i1dc2, d1i1dd2
    complexed with 16g, coa, imd

Details for d1i1db_

PDB Entry: 1i1d (more details), 1.8 Å

PDB Description: crystal structure of yeast gna1 bound to coa and glnac-6p
PDB Compounds: (B:) glucosamine-phosphate n-acetyltransferase

SCOPe Domain Sequences for d1i1db_:

Sequence, based on SEQRES records: (download)

>d1i1db_ d.108.1.1 (B:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lpdgfyirrmeegdleqvtetlkvlttvgtitpesfcklikywneatvwndnedkkimqy
npmvivdkrtetvaatgniiierkiihelglcghiediavnskyqgqglgkllidqlvti
gfdygcykiildcdeknvkfyekcgfsnagvemqirk

Sequence, based on observed residues (ATOM records): (download)

>d1i1db_ d.108.1.1 (B:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lpdgfyirrmeegdleqvtetlkvlttvgtitpesfcklikywneatvwndkkimqynpm
vivdkrtetvaatgniiierkiihelglcghiediavnskyqgqglgkllidqlvtigfd
ygcykiildcdeknvkfyekcgfsnagvemqirk

SCOPe Domain Coordinates for d1i1db_:

Click to download the PDB-style file with coordinates for d1i1db_.
(The format of our PDB-style files is described here.)

Timeline for d1i1db_: