SCOP 1.71: Domain d1i18b_: 1i18 B:

Lineage for d1i18b_ (1i18 B:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families)

5. Family b.43.4.3: Riboflavin synthase [63783] (1 protein)
   duplication: consists of two homologous domains

6. Protein Riboflavin synthase [63784] (2 species)
   trimerizes via the additional C-terminal helix

7. Species Escherichia coli [TaxId:562] [63785] (4 PDB entries)

8. Domain d1i18b_: 1i18 B: [61521]
   N-terminal domain only
   complexed with rbf

Details for d1i18b_

PDB Entry: 1i18

PDB Description: solution structure of the n-terminal domain of riboflavin synthase from e. coli

SCOP Domain Sequences for d1i18b_:

Sequence; same for both SEQRES and ATOM records:

>d1i18b_ b.43.4.3 (B:) Riboflavin synthase {Escherichia coli}
mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
fdlmketlritnlgdlkvgdwvnveraakfsdeiggh

Timeline for d1i18b_:

• d1i18b_ first appeared in SCOP 1.57
  
• d1i18b_ appears in SCOP 1.69
  
• d1i18b_ appears in SCOP 1.73
  
• d1i18b_ appears in the current release, SCOPe 2.08