Lineage for d1i18a_ (1i18 A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111309Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 111386Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 111482Family b.43.4.3: Riboflavin synthase [63783] (1 protein)
  6. 111483Protein Riboflavin synthase [63784] (1 species)
  7. 111484Species Escherichia coli [TaxId:562] [63785] (3 PDB entries)
  8. 111493Domain d1i18a_: 1i18 A: [61520]

Details for d1i18a_

PDB Entry: 1i18 (more details)

PDB Description: solution structure of the n-terminal domain of riboflavin synthase from e. coli

SCOP Domain Sequences for d1i18a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i18a_ b.43.4.3 (A:) Riboflavin synthase {Escherichia coli}
mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
fdlmketlritnlgdlkvgdwvnveraakfsdeiggh

SCOP Domain Coordinates for d1i18a_:

Click to download the PDB-style file with coordinates for d1i18a_.
(The format of our PDB-style files is described here.)

Timeline for d1i18a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1i18b_