Lineage for d1i12b_ (1i12 B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1921278Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1921279Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1921280Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1921352Protein Glucosamine-phosphate N-acetyltransferase GNA1 [64351] (1 species)
  7. 1921353Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64352] (3 PDB entries)
  8. 1921355Domain d1i12b_: 1i12 B: [61516]
    complexed with aco, imd

Details for d1i12b_

PDB Entry: 1i12 (more details), 1.3 Å

PDB Description: crystal structure of saccharomyces cerevisiae gna1 complexed with accoa
PDB Compounds: (B:) glucosamine-phosphate n-acetyltransferase

SCOPe Domain Sequences for d1i12b_:

Sequence, based on SEQRES records: (download)

>d1i12b_ d.108.1.1 (B:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
slpdgfyirrmeegdleqvtetlkvlttvgtitpesfcklikywneatvwndnedkkimq
ynpmvivdkrtetvaatgniiierkiihelglcghiediavnskyqgqglgkllidqlvt
igfdygcykiildcdeknvkfyekcgfsnagvemqirk

Sequence, based on observed residues (ATOM records): (download)

>d1i12b_ d.108.1.1 (B:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
slpdgfyirrmeegdleqvtetlkvlttvgtitpesfcklikywneatvwnkkimqynpm
vivdkrtetvaatgniiierkiihelglcghiediavnskyqgqglgkllidqlvtigfd
ygcykiildcdeknvkfyekcgfsnagvemqirk

SCOPe Domain Coordinates for d1i12b_:

Click to download the PDB-style file with coordinates for d1i12b_.
(The format of our PDB-style files is described here.)

Timeline for d1i12b_: