Lineage for d1i10e2 (1i10 E:160-331)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1680346Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1680347Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1680348Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1680355Protein Lactate dehydrogenase [56339] (19 species)
  7. 1680407Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [64445] (7 PDB entries)
  8. 1680432Domain d1i10e2: 1i10 E:160-331 [61508]
    Other proteins in same PDB: d1i10a1, d1i10b1, d1i10c1, d1i10d1, d1i10e1, d1i10f1, d1i10g1, d1i10h1
    complexed with act, nai, oxm

Details for d1i10e2

PDB Entry: 1i10 (more details), 2.3 Å

PDB Description: human muscle l-lactate dehydrogenase m chain, ternary complex with nadh and oxamate
PDB Compounds: (E:) l-lactate dehydrogenase m chain

SCOPe Domain Sequences for d1i10e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i10e2 d.162.1.1 (E:160-331) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgt
dkdkeqwkevhkqvvesayeviklkgytswaiglsvadlaesimknlrrvhpvstmikgl
ygikddvflsvpcilgqngisdlvkvtltseeearlkksadtlwgiqkelqf

SCOPe Domain Coordinates for d1i10e2:

Click to download the PDB-style file with coordinates for d1i10e2.
(The format of our PDB-style files is described here.)

Timeline for d1i10e2: