Lineage for d1i10e1 (1i10 E:1-159)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1579036Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 1579075Protein Lactate dehydrogenase [51859] (18 species)
  7. 1579124Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (7 PDB entries)
  8. 1579149Domain d1i10e1: 1i10 E:1-159 [61507]
    Other proteins in same PDB: d1i10a2, d1i10b2, d1i10c2, d1i10d2, d1i10e2, d1i10f2, d1i10g2, d1i10h2
    complexed with act, nai, oxm

Details for d1i10e1

PDB Entry: 1i10 (more details), 2.3 Å

PDB Description: human muscle l-lactate dehydrogenase m chain, ternary complex with nadh and oxamate
PDB Compounds: (E:) l-lactate dehydrogenase m chain

SCOPe Domain Sequences for d1i10e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i10e1 c.2.1.5 (E:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig

SCOPe Domain Coordinates for d1i10e1:

Click to download the PDB-style file with coordinates for d1i10e1.
(The format of our PDB-style files is described here.)

Timeline for d1i10e1: