SCOP 1.67: Domain d1i10c2: 1i10 C:160-331

Lineage for d1i10c2 (1i10 C:160-331)

Root: SCOP 1.67
Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
unusual fold, defines family
Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families)
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
Protein Lactate dehydrogenase [56339] (13 species)
Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [64445] (1 PDB entry)
Domain d1i10c2: 1i10 C:160-331 [61504]
Other proteins in same PDB: d1i10a1, d1i10b1, d1i10c1, d1i10d1, d1i10e1, d1i10f1, d1i10g1, d1i10h1

Details for d1i10c2

PDB Entry: 1i10 (more details), 2.3 Å

PDB Description: human muscle l-lactate dehydrogenase m chain, ternary complex with nadh and oxamate

SCOP Domain Sequences for d1i10c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i10c2 d.162.1.1 (C:160-331) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain)}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgt
dkdkeqwkevhkqvvesayeviklkgytswaiglsvadlaesimknlrrvhpvstmikgl
ygikddvflsvpcilgqngisdlvkvtltseeearlkksadtlwgiqkelqf

SCOP Domain Coordinates for d1i10c2:

Click to download the PDB-style file with coordinates for d1i10c2.
(The format of our PDB-style files is described here.)

Timeline for d1i10c2: