Lineage for d1i10a1 (1i10 A:1-159)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844315Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2844354Protein Lactate dehydrogenase [51859] (19 species)
  7. 2844420Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (39 PDB entries)
  8. 2844513Domain d1i10a1: 1i10 A:1-159 [61499]
    Other proteins in same PDB: d1i10a2, d1i10b2, d1i10c2, d1i10d2, d1i10e2, d1i10f2, d1i10g2, d1i10h2
    complexed with act, nai, oxm

Details for d1i10a1

PDB Entry: 1i10 (more details), 2.3 Å

PDB Description: human muscle l-lactate dehydrogenase m chain, ternary complex with nadh and oxamate
PDB Compounds: (A:) l-lactate dehydrogenase m chain

SCOPe Domain Sequences for d1i10a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i10a1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig

SCOPe Domain Coordinates for d1i10a1:

Click to download the PDB-style file with coordinates for d1i10a1.
(The format of our PDB-style files is described here.)

Timeline for d1i10a1: