SCOP 1.69: Domain d1i0zb2: 1i0z B:161-332

Lineage for d1i0zb2 (1i0z B:161-332)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)

6. Protein Lactate dehydrogenase [56339] (14 species)

7. Species Human (Homo sapiens), heart isoform (H chain) [TaxId:9606] [64444] (2 PDB entries)

8. Domain d1i0zb2: 1i0z B:161-332 [61498]
   Other proteins in same PDB: d1i0za1, d1i0zb1

Details for d1i0zb2

PDB Entry: 1i0z, 2.1 Å

PDB Description: human heart l-lactate dehydrogenase h chain, ternary complex with nadh and oxamate

SCOP Domain Sequences for d1i0zb2:

Sequence; same for both SEQRES and ATOM records:

>d1i0zb2 d.162.1.1 (B:161-332) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain)}
sgcnldsarfrylmaeklgihpsschgwilgehgdssvavwsgvnvagvslqelnpemgt
dndsenwkevhkmvvesayeviklkgytnwaiglsvadliesmlknlsrihpvstmvkgm
ygienevflslpcilnargltsvinqklkddevaqlkksadtlwdiqkdlkd

Timeline for d1i0zb2:

• d1i0zb2 first appeared in SCOP 1.57
  
• d1i0zb2 appears in SCOP 1.67
  
• d1i0zb2 appears in SCOP 1.71
  
• d1i0zb2 appears in the current release, SCOPe 2.08