Lineage for d1i0zb1 (1i0z B:1-160)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1579036Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 1579075Protein Lactate dehydrogenase [51859] (18 species)
  7. 1579117Species Human (Homo sapiens), heart isoform (H chain) [TaxId:9606] [63939] (2 PDB entries)
  8. 1579119Domain d1i0zb1: 1i0z B:1-160 [61497]
    Other proteins in same PDB: d1i0za2, d1i0zb2
    complexed with nai, oxm

Details for d1i0zb1

PDB Entry: 1i0z (more details), 2.1 Å

PDB Description: human heart l-lactate dehydrogenase h chain, ternary complex with nadh and oxamate
PDB Compounds: (B:) l-lactate dehydrogenase h chain

SCOPe Domain Sequences for d1i0zb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i0zb1 c.2.1.5 (B:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]}
atlkekliapvaeeeatvpnnkitvvgvgqvgmacaisilgksladelalvdvledklkg
emmdlqhgslflqtpkivadkdysvtanskivvvtagvrqqegesrlnlvqrnvnvfkfi
ipqivkyspdciiivvsnpvdiltyvtwklsglpkhrvig

SCOPe Domain Coordinates for d1i0zb1:

Click to download the PDB-style file with coordinates for d1i0zb1.
(The format of our PDB-style files is described here.)

Timeline for d1i0zb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i0zb2