Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein Lactate dehydrogenase [51859] (18 species) |
Species Human (Homo sapiens), heart isoform (H chain) [TaxId:9606] [63939] (2 PDB entries) |
Domain d1i0zb1: 1i0z B:1-160 [61497] Other proteins in same PDB: d1i0za2, d1i0zb2 complexed with nai, oxm |
PDB Entry: 1i0z (more details), 2.1 Å
SCOPe Domain Sequences for d1i0zb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i0zb1 c.2.1.5 (B:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} atlkekliapvaeeeatvpnnkitvvgvgqvgmacaisilgksladelalvdvledklkg emmdlqhgslflqtpkivadkdysvtanskivvvtagvrqqegesrlnlvqrnvnvfkfi ipqivkyspdciiivvsnpvdiltyvtwklsglpkhrvig
Timeline for d1i0zb1: