SCOP 1.67: Domain d1i0zb1: 1i0z B:1-160

Lineage for d1i0zb1 (1i0z B:1-160)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (7 proteins)

6. Protein Lactate dehydrogenase [51859] (13 species)

7. Species Human (Homo sapiens), heart isoform (H chain) [TaxId:9606] [63939] (2 PDB entries)

8. Domain d1i0zb1: 1i0z B:1-160 [61497]
   Other proteins in same PDB: d1i0za2, d1i0zb2
   complexed with nai, oxm

Details for d1i0zb1

PDB Entry: 1i0z, 2.1 Å

PDB Description: human heart l-lactate dehydrogenase h chain, ternary complex with nadh and oxamate

SCOP Domain Sequences for d1i0zb1:

Sequence; same for both SEQRES and ATOM records:

>d1i0zb1 c.2.1.5 (B:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain)}
atlkekliapvaeeeatvpnnkitvvgvgqvgmacaisilgksladelalvdvledklkg
emmdlqhgslflqtpkivadkdysvtanskivvvtagvrqqegesrlnlvqrnvnvfkfi
ipqivkyspdciiivvsnpvdiltyvtwklsglpkhrvig

Timeline for d1i0zb1:

• d1i0zb1 first appeared in SCOP 1.57
  
• d1i0zb1 appears in SCOP 1.65
  
• d1i0zb1 appears in SCOP 1.69
  
• d1i0zb1 appears in the current release, SCOPe 2.08