| Class g: Small proteins [56992] (92 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
| Family g.3.11.1: EGF-type module [57197] (23 proteins) |
| Protein Low density lipoprotein (LDL) receptor, different EGF domains [64539] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [64540] (7 PDB entries) Uniprot P01130 272-353 |
| Domain d1i0ua2: 1i0u A:42-82 [61494] complexed with ca |
PDB Entry: 1i0u (more details)
SCOPe Domain Sequences for d1i0ua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}
idecqdpdtcsqlcvnleggykcqceegfqldphtkackav
Timeline for d1i0ua2: