Lineage for d1i0sa_ (1i0s A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111539Fold b.45: FMN-binding split barrel [50474] (1 superfamily)
  4. 111540Superfamily b.45.1: FMN-binding split barrel [50475] (2 families) (S)
  5. 111558Family b.45.1.2: NADH:FMN oxidoreductase-like [50482] (2 proteins)
  6. 111559Protein Ferric reductase [63787] (1 species)
  7. 111560Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [63788] (2 PDB entries)
  8. 111563Domain d1i0sa_: 1i0s A: [61491]

Details for d1i0sa_

PDB Entry: 1i0s (more details), 1.65 Å

PDB Description: archaeoglobus fulgidus ferric reductase complex with nadp+

SCOP Domain Sequences for d1i0sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i0sa_ b.45.1.2 (A:) Ferric reductase {Archaeon Archaeoglobus fulgidus}
mdveafykisyglyivtsesngrkcgqiantvfqltskpvqiavclnkendthnavkesg
afgvsvleletpmefigrfgfrkssefekfdgveyktgktgvplvtqhavavieakvvke
cdvgthtlfvgeavdaevlkdaevltyadyhlmkkgktprt

SCOP Domain Coordinates for d1i0sa_:

Click to download the PDB-style file with coordinates for d1i0sa_.
(The format of our PDB-style files is described here.)

Timeline for d1i0sa_: