SCOP 1.57: Domain d1i0rb_: 1i0r B:

Lineage for d1i0rb_ (1i0r B:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.45: FMN-binding split barrel [50474] (1 superfamily)

4. Superfamily b.45.1: FMN-binding split barrel [50475] (2 families)

5. Family b.45.1.2: NADH:FMN oxidoreductase-like [50482] (2 proteins)

6. Protein Ferric reductase [63787] (1 species)

7. Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [63788] (2 PDB entries)

8. Domain d1i0rb_: 1i0r B: [61490]

Details for d1i0rb_

PDB Entry: 1i0r, 1.5 Å

PDB Description: crystal structure of ferric reductase from archaeoglobus fulgidus

SCOP Domain Sequences for d1i0rb_:

Sequence; same for both SEQRES and ATOM records:

>d1i0rb_ b.45.1.2 (B:) Ferric reductase {Archaeon Archaeoglobus fulgidus}
mdveafykisyglyivtsesngrkcgqiantvfqltskpvqiavclnkendthnavkesg
afgvsvleletpmefigrfgfrkssefekfdgveyktgktgvplvtqhavavieakvvke
cdvgthtlfvgeavdaevlkdaevltyadyhlmkkgktprtatvyfes

Timeline for d1i0rb_:

• d1i0rb_ is new in SCOP 1.57
  
• d1i0rb_ appears in SCOP 1.59
  
• d1i0rb_ appears in the current release, SCOPe 2.08