Lineage for d1i0rb_ (1i0r B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794132Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2794133Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2794274Family b.45.1.2: NADH:FMN oxidoreductase-like [50482] (5 proteins)
    different dimerization mode than in the PNP-oxidase like family
  6. 2794275Protein Ferric reductase [63787] (1 species)
  7. 2794276Species Archaeoglobus fulgidus [TaxId:2234] [63788] (2 PDB entries)
  8. 2794278Domain d1i0rb_: 1i0r B: [61490]
    complexed with fmn

Details for d1i0rb_

PDB Entry: 1i0r (more details), 1.5 Å

PDB Description: crystal structure of ferric reductase from archaeoglobus fulgidus
PDB Compounds: (B:) conserved hypothetical protein

SCOPe Domain Sequences for d1i0rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i0rb_ b.45.1.2 (B:) Ferric reductase {Archaeoglobus fulgidus [TaxId: 2234]}
mdveafykisyglyivtsesngrkcgqiantvfqltskpvqiavclnkendthnavkesg
afgvsvleletpmefigrfgfrkssefekfdgveyktgktgvplvtqhavavieakvvke
cdvgthtlfvgeavdaevlkdaevltyadyhlmkkgktprtatvyfes

SCOPe Domain Coordinates for d1i0rb_:

Click to download the PDB-style file with coordinates for d1i0rb_.
(The format of our PDB-style files is described here.)

Timeline for d1i0rb_: