![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
![]() | Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) ![]() related to the ferredoxin reductase-like FAD-binding domain |
![]() | Family b.45.1.2: NADH:FMN oxidoreductase-like [50482] (5 proteins) different dimerization mode than in the PNP-oxidase like family |
![]() | Protein Ferric reductase [63787] (1 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [63788] (2 PDB entries) |
![]() | Domain d1i0rb_: 1i0r B: [61490] complexed with fmn |
PDB Entry: 1i0r (more details), 1.5 Å
SCOPe Domain Sequences for d1i0rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i0rb_ b.45.1.2 (B:) Ferric reductase {Archaeoglobus fulgidus [TaxId: 2234]} mdveafykisyglyivtsesngrkcgqiantvfqltskpvqiavclnkendthnavkesg afgvsvleletpmefigrfgfrkssefekfdgveyktgktgvplvtqhavavieakvvke cdvgthtlfvgeavdaevlkdaevltyadyhlmkkgktprtatvyfes
Timeline for d1i0rb_: