SCOPe 2.07: Domain d1i0ra_: 1i0r A:

Lineage for d1i0ra_ (1i0r A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.2: NADH:FMN oxidoreductase-like [50482] (5 proteins)
   different dimerization mode than in the PNP-oxidase like family

6. Protein Ferric reductase [63787] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [63788] (2 PDB entries)

8. Domain d1i0ra_: 1i0r A: [61489]
   complexed with fmn

Details for d1i0ra_

PDB Entry: 1i0r, 1.5 Å

PDB Description: crystal structure of ferric reductase from archaeoglobus fulgidus

PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1i0ra_:

Sequence; same for both SEQRES and ATOM records:

>d1i0ra_ b.45.1.2 (A:) Ferric reductase {Archaeoglobus fulgidus [TaxId: 2234]}
mdveafykisyglyivtsesngrkcgqiantvfqltskpvqiavclnkendthnavkesg
afgvsvleletpmefigrfgfrkssefekfdgveyktgktgvplvtqhavavieakvvke
cdvgthtlfvgeavdaevlkdaevltyadyhlmkkgktprt

Timeline for d1i0ra_:

• d1i0ra_ first appeared in SCOP 1.57
  
• d1i0ra_ appears in SCOPe 2.06
  
• d1i0ra_ appears in the current release, SCOPe 2.08