Lineage for d1i0ra_ (1i0r A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167812Fold b.45: FMN-binding split barrel [50474] (1 superfamily)
  4. 167813Superfamily b.45.1: FMN-binding split barrel [50475] (2 families) (S)
  5. 167831Family b.45.1.2: NADH:FMN oxidoreductase-like [50482] (2 proteins)
  6. 167832Protein Ferric reductase [63787] (1 species)
  7. 167833Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [63788] (2 PDB entries)
  8. 167834Domain d1i0ra_: 1i0r A: [61489]

Details for d1i0ra_

PDB Entry: 1i0r (more details), 1.5 Å

PDB Description: crystal structure of ferric reductase from archaeoglobus fulgidus

SCOP Domain Sequences for d1i0ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i0ra_ b.45.1.2 (A:) Ferric reductase {Archaeon Archaeoglobus fulgidus}
mdveafykisyglyivtsesngrkcgqiantvfqltskpvqiavclnkendthnavkesg
afgvsvleletpmefigrfgfrkssefekfdgveyktgktgvplvtqhavavieakvvke
cdvgthtlfvgeavdaevlkdaevltyadyhlmkkgktprt

SCOP Domain Coordinates for d1i0ra_:

Click to download the PDB-style file with coordinates for d1i0ra_.
(The format of our PDB-style files is described here.)

Timeline for d1i0ra_: