Class b: All beta proteins [48724] (144 folds) |
Fold b.34: SH3-like barrel [50036] (15 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (1 family) |
Family b.34.2.1: SH3-domain [50045] (35 proteins) |
Protein EPS8 SH3 domain [50082] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [50083] (3 PDB entries) |
Domain d1i0ca_: 1i0c A: [61485] |
PDB Entry: 1i0c (more details), 2 Å
SCOP Domain Sequences for d1i0ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i0ca_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus)} kkyakskydfvarnsselsvmkddvleilddrrqwwkvrnasgdsgfvpnnildimrtp
Timeline for d1i0ca_: