Lineage for d1i0ad_ (1i0a D:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 51054Fold a.127: L-aspartase-like [48556] (1 superfamily)
  4. 51055Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 51056Family a.127.1.1: L-aspartase/fumarase [48558] (4 proteins)
  6. 51070Protein Argininosuccinate lyase/delta-crystallin [48564] (3 species)
  7. 51089Species Turkey (Meleagris gallopavo), delta-crystallin [TaxId:9103] [48567] (1 PDB entry)
  8. 51093Domain d1i0ad_: 1i0a D: [61482]

Details for d1i0ad_

PDB Entry: 1i0a (more details), 2.5 Å

PDB Description: crystal structure of wild type turkey delta 1 crystallin (eye lens protein)

SCOP Domain Sequences for d1i0ad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i0ad_ a.127.1.1 (D:) Argininosuccinate lyase/delta-crystallin {Turkey (Meleagris gallopavo), delta-crystallin}
imeilsssisteqrltevdiqasmayakalekasiltktelekilsglekiseesskgvl
vmtqsdediqtaierrlkeligdiagklqtgrsrneqvvtdlklllkssisvisthllql
iktlveraaieidiimpgythlqkalpirwsqfllshavaltrdserlgevkkritvlpl
gsgvlagnpleidrellrseldmtsitlnsidaiserdfvvelisvatllmihlsklaed
liifsttefgfvtlsdaystgssllpqkknpdslelirskagrvfgrlaailmvlkgips
tfskdlqedkeavldvvdtltavlqvatgvistlqinkenmekaltpellstdlalylvr
kgmpirqaqtasgkavhlaetkgitinnltledlksisplfasdvsqvfsvvnsveqyta
vggtakssvtaqieqlrellkkq

SCOP Domain Coordinates for d1i0ad_:

Click to download the PDB-style file with coordinates for d1i0ad_.
(The format of our PDB-style files is described here.)

Timeline for d1i0ad_: