Lineage for d1i0ac_ (1i0a C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010257Family a.127.1.1: L-aspartase/fumarase [48558] (6 protein domains)
  6. 2010279Protein Argininosuccinate lyase/delta-crystallin [48564] (4 species)
  7. 2010324Species Turkey (Meleagris gallopavo), delta-crystallin [TaxId:9103] [48567] (1 PDB entry)
  8. 2010327Domain d1i0ac_: 1i0a C: [61481]

Details for d1i0ac_

PDB Entry: 1i0a (more details), 2.5 Å

PDB Description: crystal structure of wild type turkey delta 1 crystallin (eye lens protein)
PDB Compounds: (C:) delta crystallin I

SCOPe Domain Sequences for d1i0ac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i0ac_ a.127.1.1 (C:) Argininosuccinate lyase/delta-crystallin {Turkey (Meleagris gallopavo), delta-crystallin [TaxId: 9103]}
dpimeilsssisteqrltevdiqasmayakalekasiltktelekilsglekiseesskg
vlvmtqsdediqtaierrlkeligdiagklqtgrsrneqvvtdlklllkssisvisthll
qliktlveraaieidiimpgythlqkalpirwsqfllshavaltrdserlgevkkritvl
plgsgvlagnpleidrellrseldmtsitlnsidaiserdfvvelisvatllmihlskla
edliifsttefgfvtlsdaystgssllpqkknpdslelirskagrvfgrlaailmvlkgi
pstfskdlqedkeavldvvdtltavlqvatgvistlqinkenmekaltpellstdlalyl
vrkgmpirqaqtasgkavhlaetkgitinnltledlksisplfasdvsqvfsvvnsveqy
tavggtakssvtaqieqlrellkkq

SCOPe Domain Coordinates for d1i0ac_:

Click to download the PDB-style file with coordinates for d1i0ac_.
(The format of our PDB-style files is described here.)

Timeline for d1i0ac_: