Lineage for d1i07b_ (1i07 B:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109314Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 109356Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 109357Family b.34.2.1: SH3-domain [50045] (20 proteins)
  6. 109422Protein EPS8 SH3 domain [50082] (1 species)
  7. 109423Species Mouse (Mus musculus) [TaxId:10090] [50083] (3 PDB entries)
  8. 109425Domain d1i07b_: 1i07 B: [61478]

Details for d1i07b_

PDB Entry: 1i07 (more details), 1.8 Å

PDB Description: eps8 sh3 domain intertwined dimer

SCOP Domain Sequences for d1i07b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i07b_ b.34.2.1 (B:) EPS8 SH3 domain {Mouse (Mus musculus)}
kkyakskydfvarnsselsvmkddvleilddrrqwwkvrnasgdsgfvpnnildimrtp

SCOP Domain Coordinates for d1i07b_:

Click to download the PDB-style file with coordinates for d1i07b_.
(The format of our PDB-style files is described here.)

Timeline for d1i07b_:

109425
d1i07b_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1i07a_