Lineage for d1i00b_ (1i00 B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1666639Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 1666640Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 1666641Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 1666674Protein Thymidylate synthase [55833] (7 species)
  7. 1666809Species Human (Homo sapiens) [TaxId:9606] [55840] (13 PDB entries)
  8. 1666820Domain d1i00b_: 1i00 B: [61476]
    complexed with d16, ump

Details for d1i00b_

PDB Entry: 1i00 (more details), 2.5 Å

PDB Description: crystal structure of human thymidylate synthase, ternary complex with dump and tomudex
PDB Compounds: (B:) Thymidylate synthase

SCOPe Domain Sequences for d1i00b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i00b_ d.117.1.1 (B:) Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606]}
selqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvleel
lwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgaeyrd
mesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvnsel
scqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhieplkiq
lqreprpfpklrilrkvekiddfkaedfqiegynphpt

SCOPe Domain Coordinates for d1i00b_:

Click to download the PDB-style file with coordinates for d1i00b_.
(The format of our PDB-style files is described here.)

Timeline for d1i00b_: