Lineage for d1hzzc_ (1hzz C:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483121Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 483122Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 483223Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (1 protein)
    binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode
  6. 483224Protein Transhydrogenase domain III (dIII) [52485] (3 species)
  7. 483232Species Rhodospirillum rubrum [TaxId:1085] [52488] (6 PDB entries)
  8. 483239Domain d1hzzc_: 1hzz C: [61474]
    Other proteins in same PDB: d1hzza1, d1hzza2, d1hzzb1, d1hzzb2
    complexed with dI component

Details for d1hzzc_

PDB Entry: 1hzz (more details), 2.5 Å

PDB Description: the asymmetric complex of the two nucleotide-binding components (di, diii) of proton-translocating transhydrogenase

SCOP Domain Sequences for d1hzzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hzzc_ c.31.1.4 (C:) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum}
svkagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpvag
rmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiygm
pildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn

SCOP Domain Coordinates for d1hzzc_:

Click to download the PDB-style file with coordinates for d1hzzc_.
(The format of our PDB-style files is described here.)

Timeline for d1hzzc_: