SCOP 1.63: Domain d1hzzc_: 1hzz C:

Lineage for d1hzzc_ (1hzz C:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (1 protein)
   binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode

6. Protein Transhydrogenase domain III (dIII) [52485] (3 species)

7. Species Rhodospirillum rubrum [TaxId:1085] [52488] (2 PDB entries)

8. Domain d1hzzc_: 1hzz C: [61474]
   Other proteins in same PDB: d1hzza1, d1hzza2, d1hzzb1, d1hzzb2
   complexed with dI component
   complexed with nad, nap

Details for d1hzzc_

PDB Entry: 1hzz, 2.5 Å

PDB Description: the asymmetric complex of the two nucleotide-binding components (di, diii) of proton-translocating transhydrogenase

SCOP Domain Sequences for d1hzzc_:

Sequence; same for both SEQRES and ATOM records:

>d1hzzc_ c.31.1.4 (C:) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum}
svkagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpvag
rmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiygm
pildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn

Timeline for d1hzzc_:

• d1hzzc_ first appeared in SCOP 1.57
  
• d1hzzc_ appears in SCOP 1.61
  
• d1hzzc_ appears in SCOP 1.65
  
• d1hzzc_ appears in the current release, SCOPe 2.08