Lineage for d1hzzc_ (1hzz C:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69230Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
  4. 69231Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families) (S)
  5. 69267Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (1 protein)
  6. 69268Protein Transhydrogenase domain III (dIII) [52485] (3 species)
  7. 69274Species Rhodospirillum rubrum [TaxId:1085] [52488] (2 PDB entries)
  8. 69275Domain d1hzzc_: 1hzz C: [61474]
    Other proteins in same PDB: d1hzza1, d1hzza2, d1hzzb1, d1hzzb2

Details for d1hzzc_

PDB Entry: 1hzz (more details), 2.5 Å

PDB Description: the asymmetric complex of the two nucleotide-binding components (di, diii) of proton-translocating transhydrogenase

SCOP Domain Sequences for d1hzzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hzzc_ c.31.1.4 (C:) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum}
svkagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpvag
rmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiygm
pildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn

SCOP Domain Coordinates for d1hzzc_:

Click to download the PDB-style file with coordinates for d1hzzc_.
(The format of our PDB-style files is described here.)

Timeline for d1hzzc_: