SCOP 1.57: Domain d1hzzb2: 1hzz B:1-143,B:327-381

Lineage for d1hzzb2 (1hzz B:1-143,B:327-381)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.23: Flavodoxin-like [52171] (17 superfamilies)

4. Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families)

5. Family c.23.12.2: L-alanine dehydrogenase-like [52297] (2 proteins)

6. Protein Nicotinamide nucleotide transhydrogenase dI component [63963] (1 species)

7. Species Rhodospirillum rubrum [TaxId:1085] [63964] (2 PDB entries)

8. Domain d1hzzb2: 1hzz B:1-143,B:327-381 [61473]
   Other proteins in same PDB: d1hzza1, d1hzzb1, d1hzzc_

Details for d1hzzb2

PDB Entry: 1hzz, 2.5 Å

PDB Description: the asymmetric complex of the two nucleotide-binding components (di, diii) of proton-translocating transhydrogenase

SCOP Domain Sequences for d1hzzb2:

Sequence; same for both SEQRES and ATOM records:

>d1hzzb2 c.23.12.2 (B:1-143,B:327-381) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum}
mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
amelmprisraqsmdilssqsnlXvaadasplfaknllnfltphvdkdtktlvmkledet
vsgtcvtrdgaivhpaltg

Timeline for d1hzzb2:

• d1hzzb2 is new in SCOP 1.57
  
• d1hzzb2 appears in SCOP 1.59
  
• d1hzzb2 appears in the current release, SCOPe 2.08