Lineage for d1hzza2 (1hzz A:1-143,A:327-371)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 481069Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 481644Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 481683Family c.23.12.2: L-alanine dehydrogenase-like [52297] (2 proteins)
  6. 481689Protein Nicotinamide nucleotide transhydrogenase dI component [63963] (1 species)
    L-alanine dehydrogenase homologue
  7. 481690Species Rhodospirillum rubrum [TaxId:1085] [63964] (6 PDB entries)
  8. 481707Domain d1hzza2: 1hzz A:1-143,A:327-371 [61471]
    Other proteins in same PDB: d1hzza1, d1hzzb1, d1hzzc_

Details for d1hzza2

PDB Entry: 1hzz (more details), 2.5 Å

PDB Description: the asymmetric complex of the two nucleotide-binding components (di, diii) of proton-translocating transhydrogenase

SCOP Domain Sequences for d1hzza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hzza2 c.23.12.2 (A:1-143,A:327-371) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum}
mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
amelmprisraqsmdilssqsnlXvaadasplfaknllnfltphvdkdtktlvmkledet
vsgtcvtrd

SCOP Domain Coordinates for d1hzza2:

Click to download the PDB-style file with coordinates for d1hzza2.
(The format of our PDB-style files is described here.)

Timeline for d1hzza2: