Lineage for d1hzwb_ (1hzw B:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) 
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins) Protein Thymidylate synthase [55833] (7 species) 
Species Human (Homo sapiens) [TaxId:9606] [55840] (5 PDB entries) 
Domain d1hzwb_: 1hzw B: [61465]
Details for d1hzwb_
PDB Entry: 1hzw (more details), 2 Å
PDB Description: crystal structure of human thymidylate synthase
SCOP Domain Sequences for d1hzwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hzwb_ d.117.1.1 (B:) Thymidylate synthase {Human (Homo sapiens)}
gselqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvlee
llwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgaeyr
dmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvnse
lscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhieplki
qlqreprpfpklrilrkvekiddfkaedfqiegynphpt
SCOP Domain Coordinates for d1hzwb_:
Click to download the PDB-style file with coordinates for d1hzwb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hzwb_:
- d1hzwb_ is new in SCOP 1.57
- d1hzwb_ appears in SCOP 1.59
- d1hzwb_ appears in the current release, SCOPe 2.08
View in 3D
