SCOP 1.69: Domain d1hzua1: 1hzu A:23-117

Lineage for d1hzua1 (1hzu A:23-117)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)

6. Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species)
   the C-terminal domain is a 8-bladed beta-propeller

7. Species Pseudomonas aeruginosa [TaxId:287] [46674] (9 PDB entries)

8. Domain d1hzua1: 1hzu A:23-117 [61460]
   Other proteins in same PDB: d1hzua2

Details for d1hzua1

PDB Entry: 1hzu, 2.7 Å

PDB Description: domain swing upon his to ala mutation in nitrite reductase of pseudomonas aeruginosa

SCOP Domain Sequences for d1hzua1:

Sequence; same for both SEQRES and ATOM records:

>d1hzua1 a.3.1.2 (A:23-117) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa}
vrtngapdmsesefneakqiyfqrcagchgvlrkgatgkpltpditqqrgqqyleality
gtplgmpnwgssgelskeqitlmakyiqhtppqpp

Timeline for d1hzua1:

• d1hzua1 first appeared in SCOP 1.57
  
• d1hzua1 appears in SCOP 1.67
  
• d1hzua1 appears in SCOP 1.71
  
• d1hzua1 appears in the current release, SCOPe 2.08