Lineage for d1hzua1 (1hzu A:23-117)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94589Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 94590Superfamily a.3.1: Cytochrome c [46626] (7 families) (S)
  5. 94805Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)
  6. 94806Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species)
  7. 94831Species Pseudomonas aeruginosa [TaxId:287] [46674] (8 PDB entries)
  8. 94834Domain d1hzua1: 1hzu A:23-117 [61460]
    Other proteins in same PDB: d1hzua2

Details for d1hzua1

PDB Entry: 1hzu (more details), 2.7 Å

PDB Description: domain swing upon his to ala mutation in nitrite reductase of pseudomonas aeruginosa

SCOP Domain Sequences for d1hzua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hzua1 a.3.1.2 (A:23-117) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa}
vrtngapdmsesefneakqiyfqrcagchgvlrkgatgkpltpditqqrgqqyleality
gtplgmpnwgssgelskeqitlmakyiqhtppqpp

SCOP Domain Coordinates for d1hzua1:

Click to download the PDB-style file with coordinates for d1hzua1.
(The format of our PDB-style files is described here.)

Timeline for d1hzua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hzua2