SCOPe 2.06: Domain d1hzta1: 1hzt A:31-182

Lineage for d1hzta1 (1hzt A:31-182)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.2: IPP isomerase-like [64369] (4 proteins)

6. Protein Isopentenyl diphosphate isomerase [64370] (2 species)

7. Species Escherichia coli [TaxId:562] [64371] (18 PDB entries)
   Uniprot Q46822

8. Domain d1hzta1: 1hzt A:31-182 [61459]
   Other proteins in same PDB: d1hzta2

Details for d1hzta1

PDB Entry: 1hzt, 1.45 Å

PDB Description: crystal structure of metal-free isopentenyl diphosphate:dimethylallyl diphosphate isomerase

PDB Compounds: (A:) isopentenyl diphosphate delta-isomerase

SCOPe Domain Sequences for d1hzta1:

Sequence; same for both SEQRES and ATOM records:

>d1hzta1 d.113.1.2 (A:31-182) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]}
lhlafsswlfnakgqllvtrralskkawpgvwtnsvcghpqlgesnedavirrcryelgv
eitppesiypdfryratdpsgivenevcpvfaarttsalqinddevmdyqwcdladvlhg
idatpwafspwmvmqatnrearkrlsaftqlk

Timeline for d1hzta1:

• d1hzta1 first appeared in SCOP 1.57, called d1hzta_
  
• d1hzta1 was called d1hzta_ in SCOPe 2.05
  
• d1hzta1 appears in SCOPe 2.07
  
• d1hzta1 appears in the current release, SCOPe 2.08