Lineage for d1hzta_ (1hzt A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 509941Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 509942Superfamily d.113.1: Nudix [55811] (5 families) (S)
  5. 510020Family d.113.1.2: IPP isomerase-like [64369] (2 proteins)
  6. 510024Protein Isopentenyl diphosphate isomerase [64370] (1 species)
  7. 510025Species Escherichia coli [TaxId:562] [64371] (11 PDB entries)
  8. 510026Domain d1hzta_: 1hzt A: [61459]

Details for d1hzta_

PDB Entry: 1hzt (more details), 1.45 Å

PDB Description: crystal structure of metal-free isopentenyl diphosphate:dimethylallyl diphosphate isomerase

SCOP Domain Sequences for d1hzta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli}
lhlafsswlfnakgqllvtrralskkawpgvwtnsvcghpqlgesnedavirrcryelgv
eitppesiypdfryratdpsgivenevcpvfaarttsalqinddevmdyqwcdladvlhg
idatpwafspwmvmqatnrearkrlsaftqlkl

SCOP Domain Coordinates for d1hzta_:

Click to download the PDB-style file with coordinates for d1hzta_.
(The format of our PDB-style files is described here.)

Timeline for d1hzta_: